Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "amo and kahalag ng salita kasaysayam"

1. "Dogs come into our lives to teach us about love and loyalty."

2. A balanced and healthy diet can help prevent chronic diseases.

3. A couple of candles lit up the room and created a cozy atmosphere.

4. A couple of phone calls and emails later, I finally got the information I needed.

5. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

6. A father's love and affection can have a significant impact on a child's emotional development and well-being.

7. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

8. A lot of laughter and joy filled the room during the family reunion.

9. A lot of noise from the construction site disturbed our peace and quiet.

10. A lot of people volunteer their time and resources to help those in need.

11. A lot of time and effort went into planning the party.

12. A successful father-child relationship often requires communication, patience, and understanding.

13. A successful marriage often requires open communication and mutual respect between a husband and wife.

14. A wedding planner can help the couple plan and organize their wedding.

15. A wife can be a source of emotional and physical intimacy for her husband.

16. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

17. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

18. Accomplishing a long-term goal can create a sense of euphoria and relief.

19. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

20. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

21. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

22. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

23. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

24. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

25. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

26. Adequate fiber intake can help regulate the digestive system and maintain gut health.

27. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

28. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

29. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

30. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

31. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

32. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

33. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

34. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

35. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

36. Ailments can be a source of stress and emotional distress for individuals and their families.

37. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

38. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

39. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

40. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

41. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

42. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

43. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

44. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

45. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

46. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

47. All is fair in love and war.

48. All these years, I have been blessed with the love and support of my family and friends.

49. All these years, I have been chasing my passions and following my heart.

50. All these years, I have been cherishing the relationships and connections that matter most to me.

51. All these years, I have been discovering who I am and who I want to be.

52. All these years, I have been grateful for the journey and excited for what the future holds.

53. All these years, I have been inspired by the resilience and strength of those around me.

54. All these years, I have been learning and growing as a person.

55. All these years, I have been learning to appreciate the present moment and not take life for granted.

56. All these years, I have been making mistakes and learning from them.

57. All these years, I have been overcoming challenges and obstacles to reach my goals.

58. All these years, I have been reminded of the importance of love, kindness, and compassion.

59. All these years, I have been striving to live a life of purpose and meaning.

60. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

61. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

62. Amazon has a reputation for being innovative and forward-thinking.

63. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

64. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

65. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

66. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

67. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

68. Amazon's customer service is known for being responsive and helpful.

69. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

70. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

71. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

72. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

73. And dami ko na naman lalabhan.

74. And often through my curtains peep

75. And she said yes? parang nag-aalangan kong tanong.

76. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

77. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

78. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

79. Ang mailap na kahulugan ng salita ay kailangan unawain nang mabuti.

80. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

81. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

82. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

83. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

84. Ant-Man can shrink in size and communicate with ants using his helmet.

85. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

86. Aquaman has superhuman strength and the ability to communicate with marine life.

87. Arabica beans are generally considered to be of higher quality and have a milder flavor.

88. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

89. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

90. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

91. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

92. Ariana is an advocate for animal rights and follows a vegan lifestyle.

93. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

94. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

95. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

96. As your bright and tiny spark

97. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

98. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

99. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

100. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

Random Sentences

1. Masaya ako dahil mayroon akong kaulayaw sa buhay.

2. La música es una forma de arte que se disfruta en todo el mundo.

3. Mayroon akong ibang mungkahi at ito ay ang dahilan kung bakit ako tumututol sa kanilang panukala.

4. O sige, humiwa sya sa karne, pumikit ka.

5. La mer Méditerranée est magnifique.

6. In recent years, television technology has continued to evolve and improve

7. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

8. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

9. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

10. Dahil sa kanyang natatanging kakayanan, naging tanyag ang bata sa iba't ibang lupalop.

11. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

12. Les sciences de la Terre étudient la composition et les processus de la Terre.

13. Nag-iisa kasing anak si Ranay.

14. Hinanap niya lahat ng kabarkada niya sa sugal at sinisi sa nangyari sa kanya.

15. Game ako jan! sagot agad ni Genna.

16. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

17. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

18. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

19. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

20. Disculpe; ¿me puede ayudar por favor?

21. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

22. Pwede ko ba malaman ang password ng inyong wifi?

23. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

24. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

25. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

26. I received a lot of gifts on my birthday.

27. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

28. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

29. Nagkalat ang mga adik sa kanto.

30. Saglit lang lang naging kami. Sabi niya sa akin..

31. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

32. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

33. She exercises at home.

34. "Love me, love my dog."

35. Masahol pa kayo sa mga hayop! Dahil sa inyong makasariling pagnanasa ay nagawa ninyong saktan ang ibang tao.

36. Kailangan mong umintindi ng kaibuturan ng kanyang pagkatao upang magkaroon kayo ng mas malalim na ugnayan.

37. Nagsusulat ako ng mga ideya at kaisipan sa aking diary.

38. Napilitan siyang bumangon at naghanda ng pagkain.

39. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

40. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

41. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

42.

43. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

44. Wala pa ba? seryoso niyang tanong.

45. Mahusay maglaro ng chess si Wesley.

46. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

47. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

48. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

49. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

50. Isa sa nasa pagamutan na iyon si Bok

Recent Searches

ipinamilimatchingtig-bebeintesementoremotedatingsoccermatandamapagodwealthmananaognapakaalattakotparurusahansiglahalamantools,kainanpaumanhinbagamasilangtuwangmakulitonlycassandrapinalayasbecomemagsasalitaelectionstumatawagpaghalikinnovationkamaiikutanneedlessstartedulingfar-reachingejecutarhumahangossupilinipinatawsiramababasag-ulotrabahomakakabalikgracemisusedbinawiantiempospaligsahankontinglamangkusinaedukasyonheartbeatbaduylingidtuloy-tuloypapanignaiilanganumanspamachinestelevisionnarinigmagulangrichnutrientes,disfrutarrawhumanotagalbagsakpamumunoitsguardaalamnamumutlabakitwalangmanynakakadatunghinabaaniyalegendarymakapagsabirestklimaekonomiyasubjectdingginsetsnapakapinagwikaanrhythmpagguhitnakaraanwithoutcontrolajohnugattoretebundoktiyakmamasyalbakapinapakinggankutodguerrerotahanansigedatagalitnagnakawkwebalumapitnagkaganitoililibreendkumaenipapahinganahantadattorneyalayjackzniceipapamanapananimnagpasensiyabugbuginnariningjokeinspirasyonmahiligpusingbiensinimulanmaghandaenvironmentbuksandriverumuuwisanggolfarplayedwayhotdogdecisionsstarcebuganasinabisulingantshirtkaaya-ayangsharmaineeventsbabaengtsetimemamimililumagomaskinernagmamaktoldrinksdonepupuntahanvedvarendeandglobalisasyonmightexperienceskasinggandahawlaabigaelgumuhitadobopalangitisinuotuusapannamulaklakdesisyonanlumuwasbulaklakdoonmagtipidgodtibokgayunpamancreatematagalwarisampungnucleardalawagenerosityinspireipagtatapat